Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPH3 Rabbit Polyclonal Antibody (HRP)

NXPH3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NPH3

UniProt

Q9Z2N5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NXPH3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009156

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/3566), CF740 conjugate, 0.1mg/mL
BNC743566-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/3566), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]
TA501789BM 100 µL

alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G3]

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), 0.2mg/mL
BNUB0809-100 1x 100 µL

Cyclin D1 (CCND1/809), 0.2mg/mL

Sign In for Pricing
View Details
H3.3B (H3F3B) (NM_005324) Human Recombinant Protein
TP760046 50 µg

H3.3B (H3F3B) (NM_005324) Human Recombinant Protein

Sign In for Pricing
View Details
2310002J21Rik Mouse Gene Knockout Kit (CRISPR)
KN501993 1 Kit

2310002J21Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human/Mouse KLRG-1 Antibody[2F1]
E-AB-F1273Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human/Mouse KLRG-1 Antibody[2F1]

Sign In for Pricing
View Details