Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNMA2 Rabbit Polyclonal Antibody (HRP)

PNMA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MA2, MM2, RGAG2

UniProt

Q9UL42

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PNMA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELKDQGPPPSFLELMKVIREEEEEEASFENESIEEPEERDGYGRWNHEGD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_009188

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HK3 Rabbit Polyclonal Antibody
orb2955092-01 50 µg

HK3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HK3 Rabbit Polyclonal Antibody
orb2955092-02 100 µg

HK3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM4 Antibody Blocking Peptide
orb1503069 500 µg

PDLIM4 Antibody Blocking Peptide

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 alpha (MIP-1 alpha, CCL3, LD78 alpha) (MaxLight 490) discontinued
M1202-25B-ML490 100 µL

Macrophage Inflammatory Protein 1 alpha (MIP-1 alpha, CCL3, LD78 alpha) (MaxLight 490) discontinued

Sign In for Pricing
View Details
MAP1ALC3 (T6) (LC3, APG8B, MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtub
MBS6318240-01 0.1 mL

MAP1ALC3 (T6) (LC3, APG8B, MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtub

Sign In for Pricing
View Details
MAP1ALC3 (T6) (LC3, APG8B, MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtub
MBS6318240-02 5x 0.1 mL

MAP1ALC3 (T6) (LC3, APG8B, MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtub

Sign In for Pricing
View Details