Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vps45 Rabbit Polyclonal Antibody (HRP)

Vps45 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MVp, mVps45, AI462172, AW554165

UniProt

P97390

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_038869

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Receptor Interacting Serine Threonine Kinase 1 (RIPK1) ELISA Kit
DLR-RIPK1-Hu-01 48 Tests

Human Receptor Interacting Serine Threonine Kinase 1 (RIPK1) ELISA Kit

Sign In for Pricing
View Details
Human Receptor Interacting Serine Threonine Kinase 1 (RIPK1) ELISA Kit
DLR-RIPK1-Hu-02 96 Tests

Human Receptor Interacting Serine Threonine Kinase 1 (RIPK1) ELISA Kit

Sign In for Pricing
View Details
GluR1 (phospho-S849) polyclonal antibody
BS4792-01 50 µL

GluR1 (phospho-S849) polyclonal antibody

Sign In for Pricing
View Details
GluR1 (phospho-S849) polyclonal antibody
BS4792-02 100 µL

GluR1 (phospho-S849) polyclonal antibody

Sign In for Pricing
View Details
Rat SPP1 Matched Antibody Pair Set [ABP-S-04854]
ABP-S-04854 5 Plates

Rat SPP1 Matched Antibody Pair Set [ABP-S-04854]

Sign In for Pricing
View Details
Texas red-X, SE
E37F22127-10 mg 10 mg

Texas red-X, SE

Sign In for Pricing
View Details