Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC3 Rabbit Polyclonal Antibody (FITC)

EXOC3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SEC6, Sec6p, SEC6L1

UniProt

Q6P2E8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EXOC3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_009208

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBQLN2 Conjugated Antibody
orb1616406 100 µL

UBQLN2 Conjugated Antibody

Sign In for Pricing
View Details
DENND10 Human Over-expression Lysate
orb1355545 100 µg

DENND10 Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human FNDC8 shRNA (UAS) - Lentiviral human FNDC8 shRNA (UAS, RFP) plasmid
GTR15100177 1 Vial

Lentiviral human FNDC8 shRNA (UAS) - Lentiviral human FNDC8 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
MSBP3 sgRNA CRISPR Lentivector (Human) (Target 3)
K1347904 1.0 µg DNA

MSBP3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GROS1 (Growth Suppressor 1, Leucine- and Proline-enriched Proteoglycan 1, LEPRE1, Leprecan-1, MGC117314, OI8, Prolyl 3-hydroxylase 1, P3H1, PSEC0109)
MBS641952-01 0.05 mg

GROS1 (Growth Suppressor 1, Leucine- and Proline-enriched Proteoglycan 1, LEPRE1, Leprecan-1, MGC117314, OI8, Prolyl 3-hydroxylase 1, P3H1, PSEC0109)

Sign In for Pricing
View Details
GROS1 (Growth Suppressor 1, Leucine- and Proline-enriched Proteoglycan 1, LEPRE1, Leprecan-1, MGC117314, OI8, Prolyl 3-hydroxylase 1, P3H1, PSEC0109)
MBS641952-02 5x 0.05 mg

GROS1 (Growth Suppressor 1, Leucine- and Proline-enriched Proteoglycan 1, LEPRE1, Leprecan-1, MGC117314, OI8, Prolyl 3-hydroxylase 1, P3H1, PSEC0109)

Sign In for Pricing
View Details