Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWF2 Rabbit Polyclonal Antibody (Biotin)

TWF2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A6r, A6RP, PTK9L, MSTP011

UniProt

Q6IBS0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWD

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009215

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPX1 AAV Vector (Human) (CMV)
22619101 1 µg

GPX1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (APC)
MBS6268519-01 0.1 mL

CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (APC)

Sign In for Pricing
View Details
CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (APC)
MBS6268519-02 5x 0.1 mL

CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (APC)

Sign In for Pricing
View Details
Rat Monoclonal CD97 Antibody (2Q42) [Allophycocyanin]
NBP2-22000APC 0.1 mL

Rat Monoclonal CD97 Antibody (2Q42) [Allophycocyanin]

Sign In for Pricing
View Details
DOCK8 Peptide
7847P 0.05 mg

DOCK8 Peptide

Sign In for Pricing
View Details
Junctional Adhesion Molecule 1 (F11R) (NM_016946) Human Recombinant Protein
E45H34433M5 20 µg

Junctional Adhesion Molecule 1 (F11R) (NM_016946) Human Recombinant Protein

Sign In for Pricing
View Details