Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWF2 Rabbit Polyclonal Antibody (HRP)

TWF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A6r, A6RP, PTK9L, MSTP011

UniProt

Q6IBS0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWD

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009215

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD9B Protein Vector (Human) (pPM-C-HA)
PV034227 500 ng

RAD9B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Monoclonal Osteopontin/OPN Antibody (001)
NBP2-89443-50ul 50 µL

Rabbit Monoclonal Osteopontin/OPN Antibody (001)

Sign In for Pricing
View Details
pev731-slc22a18 Plasmid
PVTB00513-4a 2 µg

pev731-slc22a18 Plasmid

Sign In for Pricing
View Details
MafB HDR Plasmid (h2)
sc-400554-HDR-2 20 µg

MafB HDR Plasmid (h2)

Sign In for Pricing
View Details
KNDC1 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-10056R-PE-Cy5.5 100 µL

KNDC1 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
MAP3K5 CRISPRa sgRNA lentivector (set of three targets)(Human)
28032121 3x 1.0µg DNA

MAP3K5 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details