Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWF2 Rabbit Polyclonal Antibody (HRP)

TWF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A6r, A6RP, PTK9L, MSTP011

UniProt

Q6IBS0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWD

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009215

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tridocosahexaenoin 95%
MBS393013 Inquire

Tridocosahexaenoin 95%

Sign In for Pricing
View Details
Recombinant Mouse Cfd Protein, C-His-tagged
IMP-1581 50 µg

Recombinant Mouse Cfd Protein, C-His-tagged

Sign In for Pricing
View Details
Recombinant Human AMOTL2/LCCP Protein, N-His
YHK88501 100 μg

Recombinant Human AMOTL2/LCCP Protein, N-His

Sign In for Pricing
View Details
Recombinant Human Charged multivesicular body protein 1b Protein, GST, E.coli-100ug
QP7751-ec-100ug 100ug

Recombinant Human Charged multivesicular body protein 1b Protein, GST, E.coli-100ug

Sign In for Pricing
View Details
Hsd3b6 Protein Vector (Mouse) (pPM-C-His)
PV190053 500 ng

Hsd3b6 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Swine anti Human IgG (Fc specific), conjugated with TRITC
MBS571454-01 1 mL

Swine anti Human IgG (Fc specific), conjugated with TRITC

Sign In for Pricing
View Details