Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gabarapl2 Rabbit Polyclonal Antibody (HRP)

Gabarapl2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gef2

UniProt

P60522

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTF

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073197

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCN4B Protein Vector (Mouse) (pPB-N-His)
PV227067 500 ng

SCN4B Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit anti-human exocyst complex component 2 polyclonal Antibody
MBS710622-01 0.1 mL

Rabbit anti-human exocyst complex component 2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human exocyst complex component 2 polyclonal Antibody
MBS710622-02 5x 0.1 mL

Rabbit anti-human exocyst complex component 2 polyclonal Antibody

Sign In for Pricing
View Details
CD161 (KLRB1) mouse monoclonal antibody, clone B199.2, PE
SM1611RT 25 Tests

CD161 (KLRB1) mouse monoclonal antibody, clone B199.2, PE

Sign In for Pricing
View Details
Eph receptor B4 (EPHB4) (NM_004444) Human Recombinant Protein
TP710162 20 µg

Eph receptor B4 (EPHB4) (NM_004444) Human Recombinant Protein

Sign In for Pricing
View Details
5' JOE / 3' DABCYL
FP-114-20 20 to 29 nmol

5' JOE / 3' DABCYL

Sign In for Pricing
View Details