Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFDN6 Rabbit Polyclonal Antibody (HRP)

PFDN6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HKE2, KE-2, PFD6, H2-KE2

UniProt

O15212

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PFDN6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055075

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT1 293 Cell Lysate
401500 0.1 mg

WNT1 293 Cell Lysate

Sign In for Pricing
View Details
ACTGP9 sgRNA CRISPR Lentivector (Human) (Target 3)
K0036804 1.0 µg DNA

ACTGP9 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Anti-CD276 Monoclonal Antibody
DMAB34985 100 ul

Rabbit Anti-CD276 Monoclonal Antibody

Sign In for Pricing
View Details
DNAJC24 Polyclonal Conjugated Antibody
C29340 100 µL

DNAJC24 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Canine Atrial Natriuretic Peptide (ANP) ELISA Kit
MBS451536-01 48 Tests

Canine Atrial Natriuretic Peptide (ANP) ELISA Kit

Sign In for Pricing
View Details
Canine Atrial Natriuretic Peptide (ANP) ELISA Kit
MBS451536-02 96 Tests

Canine Atrial Natriuretic Peptide (ANP) ELISA Kit

Sign In for Pricing
View Details