Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITRM1 Rabbit Polyclonal Antibody (HRP)

PITRM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MP1, PreP

UniProt

E7ES23

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PITRM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RDPFFKMLNRSLSTFMNAFTASDYTLYPFSTQNPKDFQNLLSVYLDATFF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001229238

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glutamate [NMDA] receptor subunit epsilon-2 (GRIN2B) ELISA Kit
orb2809721-01 48 Tests

Human Glutamate [NMDA] receptor subunit epsilon-2 (GRIN2B) ELISA Kit

Sign In for Pricing
View Details
Human Glutamate [NMDA] receptor subunit epsilon-2 (GRIN2B) ELISA Kit
orb2809721-02 96 Tests

Human Glutamate [NMDA] receptor subunit epsilon-2 (GRIN2B) ELISA Kit

Sign In for Pricing
View Details
Human Glutamate [NMDA] receptor subunit epsilon-2 (GRIN2B) ELISA Kit
orb2809721-03 5 x 96 T

Human Glutamate [NMDA] receptor subunit epsilon-2 (GRIN2B) ELISA Kit

Sign In for Pricing
View Details
DNAJC7 (DnaJ Homolog Subfamily C Member 7, Tetratricopeptide Repeat Protein 2, TPR rEpeat Protein 2, TPR2, TTC2) (MaxLight 490)
125952-ML490 100 µL

DNAJC7 (DnaJ Homolog Subfamily C Member 7, Tetratricopeptide Repeat Protein 2, TPR rEpeat Protein 2, TPR2, TTC2) (MaxLight 490)

Sign In for Pricing
View Details
Atg12 3'UTR GFP Stable Cell Line
TU251022 1.0 mL

Atg12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RHOC (Rho-related GTP-binding Protein RhoC, Rho cDNA Clone 9, h9, ARH9, ARHC) (MaxLight 490)
R1998-10M-ML490 100 µL

RHOC (Rho-related GTP-binding Protein RhoC, Rho cDNA Clone 9, h9, ARH9, ARHC) (MaxLight 490)

Sign In for Pricing
View Details