Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADD2 Rabbit Polyclonal Antibody (HRP)

ADD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ADDB

UniProt

P35612

Immunogen

The immunogen for Anti-ADD2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADDB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQLT

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PCED1B shRNA (UAS) - Lentiviral human PCED1B shRNA (UAS, RFP) plasmid
GTR15316900 1 Vial

Lentiviral human PCED1B shRNA (UAS) - Lentiviral human PCED1B shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
ELISA Kit for Permeability Glycoprotein (Pgp)
TRV-0037596-01 24 Tests

ELISA Kit for Permeability Glycoprotein (Pgp)

Sign In for Pricing
View Details
ELISA Kit for Permeability Glycoprotein (Pgp)
TRV-0037596-02 48 Tests

ELISA Kit for Permeability Glycoprotein (Pgp)

Sign In for Pricing
View Details
ELISA Kit for Permeability Glycoprotein (Pgp)
TRV-0037596-03 96 Tests

ELISA Kit for Permeability Glycoprotein (Pgp)

Sign In for Pricing
View Details
ELISA Kit for Permeability Glycoprotein (Pgp)
TRV-0037596-04 5x 96 Tests

ELISA Kit for Permeability Glycoprotein (Pgp)

Sign In for Pricing
View Details
ELISA Kit for Permeability Glycoprotein (Pgp)
TRV-0037596-05 10x 96 Tests

ELISA Kit for Permeability Glycoprotein (Pgp)

Sign In for Pricing
View Details