Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crygs Rabbit Polyclonal Antibody (HRP)

Crygs Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P0C5E9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RFHLREIHSCKVLEGTWIFYELPSYHGRQYLLDKKEYRKPVDWGAASPAV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001103023

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAMY1 Antibody
orb838520 2 mg

BAMY1 Antibody

Sign In for Pricing
View Details
Recombinant TCL1 Antibody
V7369SAF-100UG 100 µg

Recombinant TCL1 Antibody

Sign In for Pricing
View Details
Mouse Cyclin D3 CCND3 ELISA Kit
BG-MUS10559 1 Each

Mouse Cyclin D3 CCND3 ELISA Kit

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1111016-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1111016-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1111016-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details