Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam114a2 Rabbit Polyclonal Antibody (HRP)

Fam114a2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

1810073G14Rik, 9030624B09Rik

UniProt

Q8VE88

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVREKADVLNPVITAVFLEASNSASYIQDAFQLLLPVLQISLIESKTESS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080618

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TrkA (NTRK1) (NM_001007792) Human Over-expression Lysate
LC400383 20 µg

TrkA (NTRK1) (NM_001007792) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2 + ICO-106), CF647 conjugate, 0.1mg/mL
BNC470735-500 1x 500 µL

Human Lambda Light Chain (LcN-2 + ICO-106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GDPGP1 activation kit by CRISPRa
GA118169 1 Kit

Human GDPGP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL
BNC682554-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SEZ6L (NM_021115) Human Recombinant Protein
TP313624L 1 mg

SEZ6L (NM_021115) Human Recombinant Protein

Sign In for Pricing
View Details
Human OPA3 activation kit by CRISPRa
GA112867 1 Kit

Human OPA3 activation kit by CRISPRa

Sign In for Pricing
View Details