Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSH2 Rabbit Polyclonal Antibody (FITC)

CSH2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PL, CSB, CS-2, GHB1, hCS-B

UniProt

B1A4H9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CSH2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_072171

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-4 Protein
204-IL-020 20 µg

Recombinant Human IL-4 Protein

Sign In for Pricing
View Details
Anti-CD11b  (4E10)
YF-MA13871 100 ug

Anti-CD11b (4E10)

Sign In for Pricing
View Details
Recombinant Nephroselmis olivacea Photosystem I assembly protein ycf3 (ycf3)
MBS1371089-01 0.05 mg (E-Coli)

Recombinant Nephroselmis olivacea Photosystem I assembly protein ycf3 (ycf3)

Sign In for Pricing
View Details
Recombinant Nephroselmis olivacea Photosystem I assembly protein ycf3 (ycf3)
MBS1371089-02 0.05 mg (Yeast)

Recombinant Nephroselmis olivacea Photosystem I assembly protein ycf3 (ycf3)

Sign In for Pricing
View Details
Recombinant Nephroselmis olivacea Photosystem I assembly protein ycf3 (ycf3)
MBS1371089-03 0.2 mg (E-Coli)

Recombinant Nephroselmis olivacea Photosystem I assembly protein ycf3 (ycf3)

Sign In for Pricing
View Details
Recombinant Nephroselmis olivacea Photosystem I assembly protein ycf3 (ycf3)
MBS1371089-04 0.5 mg (E-Coli)

Recombinant Nephroselmis olivacea Photosystem I assembly protein ycf3 (ycf3)

Sign In for Pricing
View Details