Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOE1 Rabbit Polyclonal Antibody (HRP)

TOE1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PCH7, TOE-1, hCaf1z

UniProt

Q96GM8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TOE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079353

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse A Disintegrin and Metalloprotease 10 ELISA Kit
MBS029062-01 48 Well

Mouse A Disintegrin and Metalloprotease 10 ELISA Kit

Sign In for Pricing
View Details
Mouse A Disintegrin and Metalloprotease 10 ELISA Kit
MBS029062-02 96 Well

Mouse A Disintegrin and Metalloprotease 10 ELISA Kit

Sign In for Pricing
View Details
Mouse A Disintegrin and Metalloprotease 10 ELISA Kit
MBS029062-03 5x 96 Well

Mouse A Disintegrin and Metalloprotease 10 ELISA Kit

Sign In for Pricing
View Details
Mouse A Disintegrin and Metalloprotease 10 ELISA Kit
MBS029062-04 10x 96 Well

Mouse A Disintegrin and Metalloprotease 10 ELISA Kit

Sign In for Pricing
View Details
Anti-Human PODXL Antibody (Mab47), PE
MBS1582233-01 50 Tests

Anti-Human PODXL Antibody (Mab47), PE

Sign In for Pricing
View Details
Anti-Human PODXL Antibody (Mab47), PE
MBS1582233-02 100 Tests

Anti-Human PODXL Antibody (Mab47), PE

Sign In for Pricing
View Details