Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAP3 Rabbit Polyclonal Antibody (Biotin)

ACAP3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CENTB5

UniProt

Q96P50

Immunogen

The immunogen is a synthetic peptide directed towards the Middle region of Human ACAP3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LQADSEKLRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSA

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Doublecortin Like Kinase 1 (DCLK1) Monoclonal Antibody
CAU30414-01 100 µL

Doublecortin Like Kinase 1 (DCLK1) Monoclonal Antibody

Sign In for Pricing
View Details
Doublecortin Like Kinase 1 (DCLK1) Monoclonal Antibody
CAU30414-02 200 µL

Doublecortin Like Kinase 1 (DCLK1) Monoclonal Antibody

Sign In for Pricing
View Details
Doublecortin Like Kinase 1 (DCLK1) Monoclonal Antibody
CAU30414-03 1 mL

Doublecortin Like Kinase 1 (DCLK1) Monoclonal Antibody

Sign In for Pricing
View Details
EYA2 Recombinant Rabbit Monoclonal Antibody [JE63-31]
HA722572 100 µL

EYA2 Recombinant Rabbit Monoclonal Antibody [JE63-31]

Sign In for Pricing
View Details
Omd sgRNA CRISPR Lentivector (Rat) (Target 1)
K6995502 1.0 µg DNA

Omd sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
MCM6 Polyclonal Antibody
orb1411317 100 µL

MCM6 Polyclonal Antibody

Sign In for Pricing
View Details