Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAP3 Rabbit Polyclonal Antibody (Biotin)

ACAP3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CENTB5

UniProt

Q96P50

Immunogen

The immunogen is a synthetic peptide directed towards the Middle region of Human ACAP3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LQADSEKLRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSA

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prkci Antibody
orb858765 2 mg

Prkci Antibody

Sign In for Pricing
View Details
OCIAD2 Rabbit Polyclonal Antibody (Fluoro550)
orb3093687 100 µg

OCIAD2 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Anti-Human OGG1 (7E2) Mouse IgG1
JP10191E 10 µg

Anti-Human OGG1 (7E2) Mouse IgG1

Sign In for Pricing
View Details
PAPSS2 Human Pre-designed siRNA Set A
HY-RS10031 1 Set

PAPSS2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Fe-EDDHA Ethylenediamine-N, N’-bis (2-hydroxyphenylacetic acid) ferric-sodium complex Plant Culture Tested
PCT0121-50G 50 g

Fe-EDDHA Ethylenediamine-N, N’-bis (2-hydroxyphenylacetic acid) ferric-sodium complex Plant Culture Tested

Sign In for Pricing
View Details
ARPP21 (NM_001267619) Human Tagged ORF Clone
RC234922 10 µg

ARPP21 (NM_001267619) Human Tagged ORF Clone

Sign In for Pricing
View Details