Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1qtnf2 Rabbit Polyclonal Antibody (Biotin)

C1qtnf2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CTR, Adih, CTRP2, 1810033K05Rik

UniProt

Q9D8U4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KKGPKGKKGEPGLPGPCSCGSSRAKSAFSVAVTKSYPRERLPIKFDKILM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dicloxacillin Sodium hydrate
C11506 25 mg

Dicloxacillin Sodium hydrate

Sign In for Pricing
View Details
Recombinant Burkholderia phytofirmans Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)
MBS1106389 Inquire

Recombinant Burkholderia phytofirmans Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Sign In for Pricing
View Details
RAI1 (Retinoic Acid Induced 1, DKFZp434A139, KIAA1820, MGC12824, SMCR, SMS) (APC)
MBS6170138-01 0.1 mL

RAI1 (Retinoic Acid Induced 1, DKFZp434A139, KIAA1820, MGC12824, SMCR, SMS) (APC)

Sign In for Pricing
View Details
RAI1 (Retinoic Acid Induced 1, DKFZp434A139, KIAA1820, MGC12824, SMCR, SMS) (APC)
MBS6170138-02 5x 0.1 mL

RAI1 (Retinoic Acid Induced 1, DKFZp434A139, KIAA1820, MGC12824, SMCR, SMS) (APC)

Sign In for Pricing
View Details
ZNF416 3'UTR GFP Stable Cell Line
TU079159 1.0 mL

ZNF416 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AAK1 Antibody
C11150-01 50 μL

AAK1 Antibody

Sign In for Pricing
View Details