Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LACTB Rabbit Polyclonal Antibody (HRP)

LACTB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

G24, MRPL56

UniProt

P83111

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LACTB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_116246

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1225 3'UTR GFP Stable Cell Line
TU264548 1.0 mL

Olr1225 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CCDC149 Protein Vector (Human) (pPM-C-His)
PV067732 500 ng

CCDC149 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
IL1R1 Protein Vector (Mouse) (pPM-C-HA)
PV191376 500 ng

IL1R1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
LAMP2 (LAMP2, Lysosome-associated membrane glycoprotein 2, CD107 antigen-like family member B, CD107b) (AP)
MBS6315107-01 0.2 mL

LAMP2 (LAMP2, Lysosome-associated membrane glycoprotein 2, CD107 antigen-like family member B, CD107b) (AP)

Sign In for Pricing
View Details
LAMP2 (LAMP2, Lysosome-associated membrane glycoprotein 2, CD107 antigen-like family member B, CD107b) (AP)
MBS6315107-02 5x 0.2 mL

LAMP2 (LAMP2, Lysosome-associated membrane glycoprotein 2, CD107 antigen-like family member B, CD107b) (AP)

Sign In for Pricing
View Details
Fibronectin Antibody
orb699544-01 20 µg

Fibronectin Antibody

Sign In for Pricing
View Details