Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RWDD2A Rabbit Polyclonal Antibody (FITC)

RWDD2A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RWDD2, dJ747H23.2

UniProt

Q9UIY3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RWDD2A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_219479

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRBP derived peptide, R16 acetate
orb1942716-01 5 mg

IRBP derived peptide, R16 acetate

Sign In for Pricing
View Details
IRBP derived peptide, R16 acetate
orb1942716-02 50 mg

IRBP derived peptide, R16 acetate

Sign In for Pricing
View Details
KChIP2, NT (KCNIP2, Kv channel-interacting protein 2, A-type potassium channel modulatory protein 2, Cardiac voltage-gated potassium channel modulatory subunit, Potassium channel-interacting protein 2)
350699 100 µg

KChIP2, NT (KCNIP2, Kv channel-interacting protein 2, A-type potassium channel modulatory protein 2, Cardiac voltage-gated potassium channel modulatory subunit, Potassium channel-interacting protein 2)

Sign In for Pricing
View Details
PERP, aa175-193 (PIGPC1, THW)
P3353 100 µg

PERP, aa175-193 (PIGPC1, THW)

Sign In for Pricing
View Details
NME5 (Nucleoside Diphosphate Kinase Homolog 5, NDK-H 5, NDP Kinase Homolog 5, Inhibitor of p53-induced Apoptosis-beta, IPIA-beta, Testis-specific nm23 Homolog, nm23-H5) (AP) discontinued
130428-AP 100 µL

NME5 (Nucleoside Diphosphate Kinase Homolog 5, NDK-H 5, NDP Kinase Homolog 5, Inhibitor of p53-induced Apoptosis-beta, IPIA-beta, Testis-specific nm23 Homolog, nm23-H5) (AP) discontinued

Sign In for Pricing
View Details
Sisunatovir
BA2245-50 50 mg

Sisunatovir

Sign In for Pricing
View Details