Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNAG1 Rabbit Polyclonal Antibody (FITC)

SNAG1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SNAG1, SH3PX2, SH3PXD3B

UniProt

Q96RF0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SNAG1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGSDDDWDD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_443102

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNG1, CT (CCNG1, CCNG, CYCG1, Cyclin-G1) (APC) discontinued
033409-APC 200 µL

CCNG1, CT (CCNG1, CCNG, CYCG1, Cyclin-G1) (APC) discontinued

Sign In for Pricing
View Details
RALY Protein Vector (Mouse) (pPM-C-HA)
PV222220 500 ng

RALY Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
MIF degrader MD13
T69525 5 mg

MIF degrader MD13

Sign In for Pricing
View Details
BRF2, Control Peptide (Transcription Factor IIIB 50kD Subunit, TFIIIB50, hTFIIIB50, B-related Factor 2, BRF-2, hBRFU, BRFU, PRO1470, FLJ11052)
147720 100 µg

BRF2, Control Peptide (Transcription Factor IIIB 50kD Subunit, TFIIIB50, hTFIIIB50, B-related Factor 2, BRF-2, hBRFU, BRFU, PRO1470, FLJ11052)

Sign In for Pricing
View Details
ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (MaxLight 490)
MBS6199608-01 0.1 mL

ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (MaxLight 490)

Sign In for Pricing
View Details
ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (MaxLight 490)
MBS6199608-02 5x 0.1 mL

ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (MaxLight 490)

Sign In for Pricing
View Details