Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP4 Rabbit Polyclonal Antibody (FITC)

GBP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mpa2

UniProt

Q96PP9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GBP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAH17889.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAU2 Antibody - C-terminal region
ARP40766_P050-25UL 25 µL

STAU2 Antibody - C-terminal region

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (rSOX9/2288), CF568 conjugate, 0.1mg/mL
BNC682288-500 1x 500 µL

SOX9 / SRY-box 9 (rSOX9/2288), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
K1826 Rabbit Polyclonal Antibody (BF405)
orb2492045 100 µL

K1826 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Cbl (A-9) Alexa Fluor® 790
sc-1651 AF790 200 µg/mL

Cbl (A-9) Alexa Fluor® 790

Sign In for Pricing
View Details
Tissue, Array, Rat Adult Normal, Multi, tissue III, heart, brain, kidney, lung, spleen, skeletal muscle, small intestine, human placenta (Paraffin)
MBS639719-01 5 Arrays

Tissue, Array, Rat Adult Normal, Multi, tissue III, heart, brain, kidney, lung, spleen, skeletal muscle, small intestine, human placenta (Paraffin)

Sign In for Pricing
View Details
Tissue, Array, Rat Adult Normal, Multi, tissue III, heart, brain, kidney, lung, spleen, skeletal muscle, small intestine, human placenta (Paraffin)
MBS639719-02 5x 5 Arrays

Tissue, Array, Rat Adult Normal, Multi, tissue III, heart, brain, kidney, lung, spleen, skeletal muscle, small intestine, human placenta (Paraffin)

Sign In for Pricing
View Details