Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tsen15 Rabbit Polyclonal Antibody (FITC)

Tsen15 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Sen15, AL023077, 5730449L18Rik

UniProt

Q8R3W5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASLSHNRIREILKASRKLQGDPELPMSFTLAIVESDSTIVYYKLTDGFML

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079953

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf151 (RBBP8NL) (NM_080833) Human Tagged Lenti ORF Clone
RC212450L4 10 µg

C20orf151 (RBBP8NL) (NM_080833) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Sptssa 3'UTR GFP Stable Cell Line
TU271148 1.0 mL

Sptssa 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RRN3 Homolog, RNA Polymerase I Transcription Factor (RRN3) Antibody
abx029433-01 80 µL

RRN3 Homolog, RNA Polymerase I Transcription Factor (RRN3) Antibody

Sign In for Pricing
View Details
RRN3 Homolog, RNA Polymerase I Transcription Factor (RRN3) Antibody
abx029433-02 400 µL

RRN3 Homolog, RNA Polymerase I Transcription Factor (RRN3) Antibody

Sign In for Pricing
View Details
Human GPR64 Alexa Fluor 700 MAb (Clone 206420)
FAB7977N-100UG 100 µg

Human GPR64 Alexa Fluor 700 MAb (Clone 206420)

Sign In for Pricing
View Details
CCDC46 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
15269064 1.0 µg DNA

CCDC46 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details