Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf160 Rabbit Polyclonal Antibody (Biotin)

C20orf160 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C20orf160, dJ310O13.5

UniProt

Q9NUG4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf160

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_542192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ICAM-1/CD54 Antibody (15.2) [DyLight 755]
NBP2-50431IR 0.1 mL

Mouse Monoclonal ICAM-1/CD54 Antibody (15.2) [DyLight 755]

Sign In for Pricing
View Details
Rabbit Monoclonal PD-L1 Antibody (PDL1/8222R) [Janelia Fluor 525]
NBP3-20876JF525 0.1 mL

Rabbit Monoclonal PD-L1 Antibody (PDL1/8222R) [Janelia Fluor 525]

Sign In for Pricing
View Details
Rat Jun Dimerization Protein 2 (JDP2) ELISA Kit
abx391515 96 Tests

Rat Jun Dimerization Protein 2 (JDP2) ELISA Kit

Sign In for Pricing
View Details
Mouse XRCC6 (X-Ray Repair Cross Complementing 6) ELISA Kit
EK243395 96 Well

Mouse XRCC6 (X-Ray Repair Cross Complementing 6) ELISA Kit

Sign In for Pricing
View Details
NCF4 (NM_013416) Human Over-expression Lysate
LY402260 100 µg

NCF4 (NM_013416) Human Over-expression Lysate

Sign In for Pricing
View Details
Tmprss3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6722608 1.0 µg DNA

Tmprss3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details