Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOD1 Rabbit Polyclonal Antibody (Biotin)

EXOD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EXOD1, ZGRF5

UniProt

A8K979

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GQIDSEFQAYVQPQEHPILSEFCMELTGIKQAQVDEGVPLKICLSQFCKW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_542394

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS6 Protein Vector (Mouse) (pPM-C-His)
PV232617 500 ng

SOCS6 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Paip1 Mouse qPCR Template Standard (NM_145457)
MK201823 1 Kit

Paip1 Mouse qPCR Template Standard (NM_145457)

Sign In for Pricing
View Details
TSSK2 (Testis-specific Serine/threonine-protein Kinase 2, TSSK-2, Testis-specific Kinase 2, TSK2, TSK-2, DiGeorge Syndrome Protein G, DGSG, DGS-G, Serine/threonine-protein Kinase 22B, STK22B, SPOGA2) (Biotin)
MBS6144966-01 0.1 mL

TSSK2 (Testis-specific Serine/threonine-protein Kinase 2, TSSK-2, Testis-specific Kinase 2, TSK2, TSK-2, DiGeorge Syndrome Protein G, DGSG, DGS-G, Serine/threonine-protein Kinase 22B, STK22B, SPOGA2) (Biotin)

Sign In for Pricing
View Details
TSSK2 (Testis-specific Serine/threonine-protein Kinase 2, TSSK-2, Testis-specific Kinase 2, TSK2, TSK-2, DiGeorge Syndrome Protein G, DGSG, DGS-G, Serine/threonine-protein Kinase 22B, STK22B, SPOGA2) (Biotin)
MBS6144966-02 5x 0.1 mL

TSSK2 (Testis-specific Serine/threonine-protein Kinase 2, TSSK-2, Testis-specific Kinase 2, TSK2, TSK-2, DiGeorge Syndrome Protein G, DGSG, DGS-G, Serine/threonine-protein Kinase 22B, STK22B, SPOGA2) (Biotin)

Sign In for Pricing
View Details
Rabbit IgG F (ab') 2 Antibody Biotin Conjugated
orb347704 2 mg

Rabbit IgG F (ab') 2 Antibody Biotin Conjugated

Sign In for Pricing
View Details
Chicken Endoglin /CD105 ELISA Kit
MBS746827-01 48 Well

Chicken Endoglin /CD105 ELISA Kit

Sign In for Pricing
View Details