Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14orf126 Rabbit Polyclonal Antibody (Biotin)

C14orf126 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ATD, C14orf126

UniProt

Q96FN9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C14orf126

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542395

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Tomato 101263163 Antibody
DZ41719 200 µL/Vial

Anti-Tomato 101263163 Antibody

Sign In for Pricing
View Details
Fmoc-N-Me-Ser (tBu) -OH
4029103.0001 1 g

Fmoc-N-Me-Ser (tBu) -OH

Sign In for Pricing
View Details
Rabbit anti-Staphylococcus aureus (strain COL) fabH Polyclonal Antibody
MBS7194964 Inquire

Rabbit anti-Staphylococcus aureus (strain COL) fabH Polyclonal Antibody

Sign In for Pricing
View Details
APPD Rabbit Polyclonal Antibody (AP)
orb885569 100 µL

APPD Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Concanavalin A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS
MT07F4-CON_A 1 Plate

Concanavalin A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Clear PS

Sign In for Pricing
View Details
DSP 3'UTR GFP Stable Cell Line
TU056349 1.0 mL

DSP 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details