Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14orf126 Rabbit Polyclonal Antibody (HRP)

C14orf126 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATD, C14orf126

UniProt

Q96FN9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C14orf126

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542395

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Paired mesoderm homeobox protein 2, PRRX2 ELISA KIT
ELI-36245h 96 Tests

Human Paired mesoderm homeobox protein 2, PRRX2 ELISA KIT

Sign In for Pricing
View Details
Human CRYBB3 (NM_004076) AAV Particle
RC216611A1V 250 µL

Human CRYBB3 (NM_004076) AAV Particle

Sign In for Pricing
View Details
RBM9 Rabbit Polyclonal Antibody
orb324851 100 µL

RBM9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,4-D Rabbit pAb, PerCP-Cy7 conjugated
orb2849727 100 µL

2,4-D Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
SKAP1 rabbit pAb Antibody
orb773822-01 50 μL

SKAP1 rabbit pAb Antibody

Sign In for Pricing
View Details
SKAP1 rabbit pAb Antibody
orb773822-02 100 µL

SKAP1 rabbit pAb Antibody

Sign In for Pricing
View Details