Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLL2 Rabbit Polyclonal Antibody (HRP)

DYNLL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dlc2, DNCL1B, RSPH22

UniProt

Q96FJ2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DYNLL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_542408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solute carrier family 22 member 5 (SLC22A5) (NM_003060) Human Tagged Lenti ORF Clone
RC204177L4 10 µg

Solute carrier family 22 member 5 (SLC22A5) (NM_003060) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FUS Recombinant Rabbit Monoclonal Antibody
orb2562740-01 25 µL

FUS Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FUS Recombinant Rabbit Monoclonal Antibody
orb2562740-02 50 µL

FUS Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FUS Recombinant Rabbit Monoclonal Antibody
orb2562740-03 100 µL

FUS Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-SLITRK6 antibody
PAab07984 100 µg

Anti-SLITRK6 antibody

Sign In for Pricing
View Details
CHEK1 Rabbit Polyclonal Antibody (HRP)
orb2139567 100 µL

CHEK1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details