Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLL2 Rabbit Polyclonal Antibody (HRP)

DYNLL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dlc2, DNCL1B, RSPH22

UniProt

Q96FJ2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DYNLL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_542408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CEACAM5/CD66e Antibody (061) [HRP]
NBP2-89785H 0.1 mL

Rabbit Monoclonal CEACAM5/CD66e Antibody (061) [HRP]

Sign In for Pricing
View Details
Rat GFAP (Glial Fibrillary Acidic Protein) ELISA Kit
E-EL-R1428-01 24 Tests

Rat GFAP (Glial Fibrillary Acidic Protein) ELISA Kit

Sign In for Pricing
View Details
Rat GFAP (Glial Fibrillary Acidic Protein) ELISA Kit
E-EL-R1428-02 48 Tests

Rat GFAP (Glial Fibrillary Acidic Protein) ELISA Kit

Sign In for Pricing
View Details
Rat GFAP (Glial Fibrillary Acidic Protein) ELISA Kit
E-EL-R1428-03 96 Tests

Rat GFAP (Glial Fibrillary Acidic Protein) ELISA Kit

Sign In for Pricing
View Details
NUP155 Antibody
30-903 100 µL

NUP155 Antibody

Sign In for Pricing
View Details
VWF CRISPR Activation Plasmid (h2)
sc-400217-ACT-2 20 µg

VWF CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details