Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEURL2 Rabbit Polyclonal Antibody (Biotin)

NEURL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OZZ, OZZ-E3, C20orf163

UniProt

Q9BR09

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NEURL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT9, CT (NUDT9, NUDT10, ADP-ribose pyrophosphatase, mitochondrial, ADP-ribose diphosphatase, ADP-ribose phosphohydrolase, Adenosine diphosphoribose pyrophosphatase, Nucleoside diphosphate-linked moiety X motif 9)
MBS641590-01 0.2 mL

NUDT9, CT (NUDT9, NUDT10, ADP-ribose pyrophosphatase, mitochondrial, ADP-ribose diphosphatase, ADP-ribose phosphohydrolase, Adenosine diphosphoribose pyrophosphatase, Nucleoside diphosphate-linked moiety X motif 9)

Sign In for Pricing
View Details
NUDT9, CT (NUDT9, NUDT10, ADP-ribose pyrophosphatase, mitochondrial, ADP-ribose diphosphatase, ADP-ribose phosphohydrolase, Adenosine diphosphoribose pyrophosphatase, Nucleoside diphosphate-linked moiety X motif 9)
MBS641590-02 5x 0.2 mL

NUDT9, CT (NUDT9, NUDT10, ADP-ribose pyrophosphatase, mitochondrial, ADP-ribose diphosphatase, ADP-ribose phosphohydrolase, Adenosine diphosphoribose pyrophosphatase, Nucleoside diphosphate-linked moiety X motif 9)

Sign In for Pricing
View Details
Monkey VS (Versican/PG-M) ELISA Kit
MBS2512306-01 24 Tests

Monkey VS (Versican/PG-M) ELISA Kit

Sign In for Pricing
View Details
Monkey VS (Versican/PG-M) ELISA Kit
MBS2512306-02 48 Tests

Monkey VS (Versican/PG-M) ELISA Kit

Sign In for Pricing
View Details
Monkey VS (Versican/PG-M) ELISA Kit
MBS2512306-03 96 Tests

Monkey VS (Versican/PG-M) ELISA Kit

Sign In for Pricing
View Details
Monkey VS (Versican/PG-M) ELISA Kit
MBS2512306-04 5x 96 Tests

Monkey VS (Versican/PG-M) ELISA Kit

Sign In for Pricing
View Details