Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEURL2 Rabbit Polyclonal Antibody (HRP)

NEURL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OZZ, OZZ-E3, C20orf163

UniProt

Q9BR09

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NEURL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Protein FAM169A, FAM169A ELISA Kit
MBS9339085-01 48 Well

Mouse Protein FAM169A, FAM169A ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM169A, FAM169A ELISA Kit
MBS9339085-02 96 Well

Mouse Protein FAM169A, FAM169A ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM169A, FAM169A ELISA Kit
MBS9339085-03 5x 96 Well

Mouse Protein FAM169A, FAM169A ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM169A, FAM169A ELISA Kit
MBS9339085-04 10x 96 Well

Mouse Protein FAM169A, FAM169A ELISA Kit

Sign In for Pricing
View Details
ERI3 Rabbit pAb
E47R14623 100 µL

ERI3 Rabbit pAb

Sign In for Pricing
View Details
Human muscarinic acetylcholine receptor M2, M-AChR M2 ELISA Kit
SL1220Hu-01 48 Tests

Human muscarinic acetylcholine receptor M2, M-AChR M2 ELISA Kit

Sign In for Pricing
View Details