Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASZ1 Rabbit Polyclonal Antibody (Biotin)

ASZ1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ALP1, GASZ, Orf3, ANKL1, C7orf7, CT1.19

UniProt

Q8WWH4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ASZ1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_570124

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VEGF R2/KDR/Flk-1 Recombinant Protein
PROTP35968-50ug 50 µg

Human VEGF R2/KDR/Flk-1 Recombinant Protein

Sign In for Pricing
View Details
C14orf148 (NOXRED1) (NM_001113475) Human Tagged ORF Clone Lentiviral Particle
RC225536L4V 200 µL

C14orf148 (NOXRED1) (NM_001113475) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LY86, CT (LY86, MD1, Lymphocyte antigen 86, Protein MD-1) (Azide free) (HRP)
MBS6317652-01 0.2 mL

LY86, CT (LY86, MD1, Lymphocyte antigen 86, Protein MD-1) (Azide free) (HRP)

Sign In for Pricing
View Details
LY86, CT (LY86, MD1, Lymphocyte antigen 86, Protein MD-1) (Azide free) (HRP)
MBS6317652-02 5x 0.2 mL

LY86, CT (LY86, MD1, Lymphocyte antigen 86, Protein MD-1) (Azide free) (HRP)

Sign In for Pricing
View Details
MGluR2 (D7D8M) Rabbit Monoclonal Antibody
CST 76012T 20 µL

MGluR2 (D7D8M) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-CTBP1 (Ser422) Rabbit Polyclonal Antibody (PerCP)
orb2545950 100 µL

Phospho-CTBP1 (Ser422) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details