Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASZ1 Rabbit Polyclonal Antibody (FITC)

ASZ1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ALP1, GASZ, Orf3, ANKL1, C7orf7, CT1.19

UniProt

Q8WWH4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ASZ1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_570124

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP5 (AKAP79, A-kinase Anchor Protein 5, AKAP-5, A-kinase Anchor Protein 79kD, AKAP 79, H21, cAMP-dependent Protein Kinase Regulatory Subunit II High Affinity-binding Protein) (PE)
123137-PE 100 µL

AKAP5 (AKAP79, A-kinase Anchor Protein 5, AKAP-5, A-kinase Anchor Protein 79kD, AKAP 79, H21, cAMP-dependent Protein Kinase Regulatory Subunit II High Affinity-binding Protein) (PE)

Sign In for Pricing
View Details
ADH7 Polyclonal Antibody
orb3149511-01 50 µg

ADH7 Polyclonal Antibody

Sign In for Pricing
View Details
ADH7 Polyclonal Antibody
orb3149511-02 100 µg

ADH7 Polyclonal Antibody

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)
MBS2067634-01 0.1 mL

PE-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)
MBS2067634-02 0.2 mL

PE-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)
MBS2067634-03 0.5 mL

PE-Linked Polyclonal Antibody to Osteopetrosis Associated Transmembrane Protein 1 (OSTM1)

Sign In for Pricing
View Details