Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASZ1 Rabbit Polyclonal Antibody (HRP)

ASZ1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALP1, GASZ, Orf3, ANKL1, C7orf7, CT1.19

UniProt

Q8WWH4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ASZ1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_570124

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tctn1 shRNA (UAS) - Lentiviral mouse Tctn1 shRNA (UAS, iRFP) (100)
GTR15213171 1 Vial

Lentiviral mouse Tctn1 shRNA (UAS) - Lentiviral mouse Tctn1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
D-dopachrome decarboxylase DDT Rabbit Polyclonal Antibody (FITC)
orb2580385 100 µg

D-dopachrome decarboxylase DDT Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MRGPRX3 Rabbit Polyclonal Antibody (FITC)
orb2098029 100 µL

MRGPRX3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
14-3-3 θ Antibody
orb194050-01 50 μL

14-3-3 θ Antibody

Sign In for Pricing
View Details
14-3-3 θ Antibody
orb194050-02 100 µL

14-3-3 θ Antibody

Sign In for Pricing
View Details
Anti-PAX8 Antibody
MBS820116-01 0.03 mL

Anti-PAX8 Antibody

Sign In for Pricing
View Details