Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP35 Rabbit Polyclonal Antibody (HRP)

NUP35 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MP44, NP44, MP-44, NUP53

UniProt

Q8NFH5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NUP35

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kptn sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6543008 1.0 µg DNA

Kptn sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Multiplex test, sexually transmitted infecctions (sti) detection of (mh, uu, up)
MulOneq-H844-100D 100 Reactions

Multiplex test, sexually transmitted infecctions (sti) detection of (mh, uu, up)

Sign In for Pricing
View Details
Camel CD200 Receptor 1 ELISA Kit
MBS069395-01 48 Well

Camel CD200 Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Camel CD200 Receptor 1 ELISA Kit
MBS069395-02 96 Well

Camel CD200 Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Camel CD200 Receptor 1 ELISA Kit
MBS069395-03 5x 96 Well

Camel CD200 Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Camel CD200 Receptor 1 ELISA Kit
MBS069395-04 10x 96 Well

Camel CD200 Receptor 1 ELISA Kit

Sign In for Pricing
View Details