Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAAL1 Rabbit Polyclonal Antibody (HRP)

SAAL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPACIA1

UniProt

Q96ER3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SAAL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_612430

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PATE1 sgRNA CRISPR Lentivector (Human) (Target 2)
K1597503 1.0 µg DNA

PATE1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Pan troglodytes G-protein coupled receptor 15 (GPR15), partial
MBS7097631 Inquire

Recombinant Pan troglodytes G-protein coupled receptor 15 (GPR15), partial

Sign In for Pricing
View Details
Kv1.4 Rabbit Polyclonal Antibody (Cy5.5)
orb1056623 100 µL

Kv1.4 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
B3GALT5 Human qPCR Primer Pair (NM_033172)
HP233776 200 Reactions

B3GALT5 Human qPCR Primer Pair (NM_033172)

Sign In for Pricing
View Details
NEUROG3 siRNA Oligos set (Human)
31745171 3x 5 nmol

NEUROG3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
P21, CT (Cyclin-dependent Kinase Inhibitor 1, CDK-interacting Protein 1, Melanoma Differentiation-associated Protein 6, MDA-6, CDKN1A, CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1)
P1000-53F 200 µL

P21, CT (Cyclin-dependent Kinase Inhibitor 1, CDK-interacting Protein 1, Melanoma Differentiation-associated Protein 6, MDA-6, CDKN1A, CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1)

Sign In for Pricing
View Details