Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM83F Rabbit Polyclonal Antibody (FITC)

FAM83F Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8NEG4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM83F

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KDEKAPHLKQVVRQMIQQAQKVIAVVMDLFTDGDIFQDIVDAACKRRVPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_612444

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SEC61G activation kit by CRISPRa
GA108336 1 Kit

Human SEC61G activation kit by CRISPRa

Sign In for Pricing
View Details
ACP5 Rabbit Monoclonal Antibody [KD Validation]
E51K1738 40 µL

ACP5 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
ELK4 (ETS Domain-containing Protein Elk-4, Serum Response Factor Accessory Protein 1, SAP-1, SRF Accessory Protein 1, SAP1) (MaxLight 490)
MBS6377278-01 0.1 mL

ELK4 (ETS Domain-containing Protein Elk-4, Serum Response Factor Accessory Protein 1, SAP-1, SRF Accessory Protein 1, SAP1) (MaxLight 490)

Sign In for Pricing
View Details
ELK4 (ETS Domain-containing Protein Elk-4, Serum Response Factor Accessory Protein 1, SAP-1, SRF Accessory Protein 1, SAP1) (MaxLight 490)
MBS6377278-02 5x 0.1 mL

ELK4 (ETS Domain-containing Protein Elk-4, Serum Response Factor Accessory Protein 1, SAP-1, SRF Accessory Protein 1, SAP1) (MaxLight 490)

Sign In for Pricing
View Details
SNX7 CRISPR Activation Plasmid (h)
sc-408229-ACT 20 µg

SNX7 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
MON 863 x MON 810 MAIZE (level 1 - nominal 0.1 % GMO) 1 g
ERM-BF417b 1 g

MON 863 x MON 810 MAIZE (level 1 - nominal 0.1 % GMO) 1 g

Sign In for Pricing
View Details