Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM83F Rabbit Polyclonal Antibody (HRP)

FAM83F Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NEG4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM83F

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDEKAPHLKQVVRQMIQQAQKVIAVVMDLFTDGDIFQDIVDAACKRRVPV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_612444

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMMT Peptide - middle region
MBS3248470-01 0.1 mg

IMMT Peptide - middle region

Sign In for Pricing
View Details
IMMT Peptide - middle region
MBS3248470-02 5x 0.1 mg

IMMT Peptide - middle region

Sign In for Pricing
View Details
Recombinant Mycobacterium Tuberculosis Rv2959c Protein (aa 39-245)
VAng-Yyj0744-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Tuberculosis Rv2959c Protein (aa 39-245)

Sign In for Pricing
View Details
Rabbit Anti Human IgG (H&L) -AbFluor 555
SA0761-01 100 µL

Rabbit Anti Human IgG (H&L) -AbFluor 555

Sign In for Pricing
View Details
Rabbit Anti Human IgG (H&L) -AbFluor 555
SA0761-02 1 mL

Rabbit Anti Human IgG (H&L) -AbFluor 555

Sign In for Pricing
View Details
Recombinant Human Keratin, type II cytoskeletal 6B (KRT6B)
MBS960381-01 0.02 mg (E-Coli)

Recombinant Human Keratin, type II cytoskeletal 6B (KRT6B)

Sign In for Pricing
View Details