Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM83F Rabbit Polyclonal Antibody (HRP)

FAM83F Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NEG4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM83F

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612444

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNC2H1 Human Gene Knockout Kit (CRISPR)
KN435408 1 Kit

DYNC2H1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NKX2.8 (NKX28/2548), CF488A conjugate, 0.1mg/mL
BNC882548-500 1x 500 µL

NKX2.8 (NKX28/2548), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Murine IL-10 ELISA Kit, 1 x 96-well (pre-coated)
EA101691 1x 96 Well (Pre-Coated)

Murine IL-10 ELISA Kit, 1 x 96-well (pre-coated)

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF594 conjugate, 0.1mg/mL
BNC941422-500 1x 500 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Basic Water Purification System BBPS-109
BBPS-109 1 Unit

Basic Water Purification System BBPS-109

Sign In for Pricing
View Details
Primer Panel
HPP6011C 20x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details