Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CGAS Rabbit Polyclonal Antibody (Biotin)

CGAS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MB21D1, h-cGAS, C6orf150

UniProt

Q8N884

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C6orf150

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_612450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (Chloromethyl) -2- (3,5-dichlorophenyl) -1,3-oxazole
DXB47614-01 50 mg

4- (Chloromethyl) -2- (3,5-dichlorophenyl) -1,3-oxazole

Sign In for Pricing
View Details
4- (Chloromethyl) -2- (3,5-dichlorophenyl) -1,3-oxazole
DXB47614-02 0.5 g

4- (Chloromethyl) -2- (3,5-dichlorophenyl) -1,3-oxazole

Sign In for Pricing
View Details
Islr ORF Vector (Mouse) (pORF)
ORF048105 1.0 µg DNA

Islr ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CD2 (Erythrocyte receptor, LFA-2, LFA-3 receptor, Ly-37, Lymphocyte function antigen 2, Rosette receptor, SRBC, T-cell surface antigen CD2, T-cell surface antigen T11/Leu-5, T11) (BSA & Azide Free) (MaxLight 650)
168673-AF-ML650 100 µL

CD2 (Erythrocyte receptor, LFA-2, LFA-3 receptor, Ly-37, Lymphocyte function antigen 2, Rosette receptor, SRBC, T-cell surface antigen CD2, T-cell surface antigen T11/Leu-5, T11) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
ELISA Kit for Hippocalcin Like Protein 1 (HPCAL1)
TRV-0064182-01 24 Tests

ELISA Kit for Hippocalcin Like Protein 1 (HPCAL1)

Sign In for Pricing
View Details
ELISA Kit for Hippocalcin Like Protein 1 (HPCAL1)
TRV-0064182-02 48 Tests

ELISA Kit for Hippocalcin Like Protein 1 (HPCAL1)

Sign In for Pricing
View Details