Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CGAS Rabbit Polyclonal Antibody (HRP)

CGAS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MB21D1, h-cGAS, C6orf150

UniProt

Q8N884

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C6orf150

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDC

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_612450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Serac1 shRNA (UAS) - Lentiviral mouse Serac1 shRNA (UAS) (100)
GTR15267318 1 Vial

Lentiviral mouse Serac1 shRNA (UAS) - Lentiviral mouse Serac1 shRNA (UAS) (100)

Sign In for Pricing
View Details
WAVE 1 Rabbit pAb, BF700 conjugated
orb2880221 100 µL

WAVE 1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Recombinant Human IL-6
PH2007-.01 10 µg

Recombinant Human IL-6

Sign In for Pricing
View Details
Recombinant Drosophila simulans Transmembrane GTPase fzo (fzo)
MBS7015431-01 0.02 mg

Recombinant Drosophila simulans Transmembrane GTPase fzo (fzo)

Sign In for Pricing
View Details
Recombinant Drosophila simulans Transmembrane GTPase fzo (fzo)
MBS7015431-02 0.1 mg

Recombinant Drosophila simulans Transmembrane GTPase fzo (fzo)

Sign In for Pricing
View Details
Recombinant Drosophila simulans Transmembrane GTPase fzo (fzo)
MBS7015431-03 5x 0.1 mg

Recombinant Drosophila simulans Transmembrane GTPase fzo (fzo)

Sign In for Pricing
View Details