Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL11 Rabbit Polyclonal Antibody (Biotin)

ARL11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARLTS1

UniProt

Q969Q4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARL11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_612459

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIB1 (Tribbles Homolog 1, TRB-1, C8FW, G-protein-coupled Receptor-induced Gene 2 Protein, GIG2, GIG-2, SKIP1) (MaxLight 405) discontinued
134713-ML405 100 µL

TRIB1 (Tribbles Homolog 1, TRB-1, C8FW, G-protein-coupled Receptor-induced Gene 2 Protein, GIG2, GIG-2, SKIP1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
LSD1 (Lysine-Specific Histone Demethylase, Amine Oxidase Flavin-containing Domain Protein 2, AOF2, BRAF35-HDAC Complex Protein BHC110, Flavin-containing Amine Oxidase Domain-containing Protein 2, KDM1, KDM1A, KIAA0601, Lysine-specific Histone Demethylase 1A, RP1-184J9.1) (HRP) discontinued
L4595-50M-HRP 100 µL

LSD1 (Lysine-Specific Histone Demethylase, Amine Oxidase Flavin-containing Domain Protein 2, AOF2, BRAF35-HDAC Complex Protein BHC110, Flavin-containing Amine Oxidase Domain-containing Protein 2, KDM1, KDM1A, KIAA0601, Lysine-specific Histone Demethylase 1A, RP1-184J9.1) (HRP) discontinued

Sign In for Pricing
View Details
TMPRSS11BNL, ID (TMPRSS11BNL, Transmembrane protease serine 11B-like protein, TMPRSS11B N-terminus-like protein) (MaxLight 490) discontinued
043047-ML490 100 µL

TMPRSS11BNL, ID (TMPRSS11BNL, Transmembrane protease serine 11B-like protein, TMPRSS11B N-terminus-like protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Oxycodone (OXY) Rapid Test Panel
DOX-114 40 Tests

Oxycodone (OXY) Rapid Test Panel

Sign In for Pricing
View Details
GPX1P1 ORF Vector (Human) (pORF)
ORF020399 1.0 µg DNA

GPX1P1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SNX19
CSB-CL856403HU 10 μg Plasmid + 200 μL Glycerol

SNX19

Sign In for Pricing
View Details