Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr92 Rabbit Polyclonal Antibody (FITC)

Wdr92 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HZGJ, AI553587

UniProt

Q8BGF3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NMEPAQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMSLRW

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_849240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ENAH/MENA Antibody Picoband® Fluoro594 Conjugated
A05337-2-Fluoro594 100 µg/Vial

Anti-ENAH/MENA Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Human Vesicle-associated membrane protein-associated protein A,VAPA ELISA KIT
JOT-EK6397Hu-01 48 Well

Human Vesicle-associated membrane protein-associated protein A,VAPA ELISA KIT

Sign In for Pricing
View Details
Human Vesicle-associated membrane protein-associated protein A,VAPA ELISA KIT
JOT-EK6397Hu-02 96 Well

Human Vesicle-associated membrane protein-associated protein A,VAPA ELISA KIT

Sign In for Pricing
View Details
ERCC1 Recombinant Rabbit Monoclonal Antibody
orb1172892-01 25 µL

ERCC1 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ERCC1 Recombinant Rabbit Monoclonal Antibody
orb1172892-02 50 μL

ERCC1 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ERCC1 Recombinant Rabbit Monoclonal Antibody
orb1172892-03 100 µL

ERCC1 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details