Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC3-AS1 Rabbit Polyclonal Antibody (FITC)

EXOC3-AS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C5orf55

UniProt

Q8N2X6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC116349

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PAVFMLASSSALQCGRGVPRFPRTEVGAGHSVNEETKAEKVGNQTSVIPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_612473

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YY1, ID (YY1, INO80S, Transcriptional repressor protein YY1, Delta transcription factor, INO80 complex subunit S, NF-E1, Yin and yang 1) (MaxLight 750)
MBS6364422-01 0.1 mL

YY1, ID (YY1, INO80S, Transcriptional repressor protein YY1, Delta transcription factor, INO80 complex subunit S, NF-E1, Yin and yang 1) (MaxLight 750)

Sign In for Pricing
View Details
YY1, ID (YY1, INO80S, Transcriptional repressor protein YY1, Delta transcription factor, INO80 complex subunit S, NF-E1, Yin and yang 1) (MaxLight 750)
MBS6364422-02 5x 0.1 mL

YY1, ID (YY1, INO80S, Transcriptional repressor protein YY1, Delta transcription factor, INO80 complex subunit S, NF-E1, Yin and yang 1) (MaxLight 750)

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
YP-W23367-01 48 Tests

Mouse Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
Mouse Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit
YP-W23367-02 96 Tests

Mouse Angiopoietin Like Protein 3 (ANGPTL3) ELISA Kit

Sign In for Pricing
View Details
GENLISA Human Placenta Protein13 (PP13) ELISA
KBH14669 1x 96 Well

GENLISA Human Placenta Protein13 (PP13) ELISA

Sign In for Pricing
View Details
ALDOB (NM_000035) Human Untagged Clone
SC118108 10 µg

ALDOB (NM_000035) Human Untagged Clone

Sign In for Pricing
View Details