Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC3-AS1 Rabbit Polyclonal Antibody (FITC)

EXOC3-AS1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C5orf55

UniProt

Q8N2X6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC116349

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PAVFMLASSSALQCGRGVPRFPRTEVGAGHSVNEETKAEKVGNQTSVIPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_612473

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKN1 (Protein Kinase N1, DBK, MGC46204, PAK1, PKN, PKN-ALPHA, PRK1, PRKCL1) (AP) discontinued
250162-AP 100 µL

PKN1 (Protein Kinase N1, DBK, MGC46204, PAK1, PKN, PKN-ALPHA, PRK1, PRKCL1) (AP) discontinued

Sign In for Pricing
View Details
CBS Knockout MES-OV Polyclonal Cells
ARG42745 1 Million

CBS Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Hu_CEACAM6 K562 Cell Line
E33C100058 1 Vial

Hu_CEACAM6 K562 Cell Line

Sign In for Pricing
View Details
CD14 (CD14 Antigen, Lipopolysaccharide Receptor, LPSR, Monocyte Differentiation Antigen 14, Myeloid Cell Specific Leucine Rich Glycoprotein) (MaxLight 405) discontinued
C2265-32P-ML405 100 µL

CD14 (CD14 Antigen, Lipopolysaccharide Receptor, LPSR, Monocyte Differentiation Antigen 14, Myeloid Cell Specific Leucine Rich Glycoprotein) (MaxLight 405) discontinued

Sign In for Pricing
View Details
APPBP1 (NAE1, NEDD8-activating Enzyme E1 Regulatory Subunit, Amyloid beta Precursor Protein-binding Protein 1, 59kD, Amyloid Protein-binding Protein 1, Proto-oncogene Protein 1, A-116A10.1, HPP1, Ula-1) (MaxLight 550)
123448-ML550 100 µL

APPBP1 (NAE1, NEDD8-activating Enzyme E1 Regulatory Subunit, Amyloid beta Precursor Protein-binding Protein 1, 59kD, Amyloid Protein-binding Protein 1, Proto-oncogene Protein 1, A-116A10.1, HPP1, Ula-1) (MaxLight 550)

Sign In for Pricing
View Details
LOC100364611 3'UTR GFP Stable Cell Line
TU259172 1.0 mL

LOC100364611 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details