Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C11orf74 Rabbit Polyclonal Antibody (Biotin)

C11orf74 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NWC, HEPIS, C11orf74

UniProt

Q86VG3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C11orf74

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_620142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKK beta, CT (I kappa B Kinase 2, I kappa B Kinase beta, I-kappa-B Kinase 2, I-kappa-B-kinase beta, IkBKB, IKK 2, IKK B, IKK beta, IKK-B, IKK-beta, IKK2, IKKB, IKKB_HUMAN, Inhibitor of kappa Light Chain Gene Enhancer in B Cells, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells Kinase beta, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells Kinase beta, Inhibitor of Nuclear Factor kappa B Kinase beta Subunit, Inhibitor of Nuclear Factor kappa B Kinase Subunit beta, Inhibitor of Nuclear Factor kappa-B Kinase Subunit beta, NFKBIKB, Nuclear Factor NF kappa B Inhibitor Kinase beta, Nuclear Factor NF-kappa-B Inhibitor Kinase beta, Nuclear Factor of kappa Light Chain Gene Enhancer in B Cells Inhibitor)
303381 100 µg

IKK beta, CT (I kappa B Kinase 2, I kappa B Kinase beta, I-kappa-B Kinase 2, I-kappa-B-kinase beta, IkBKB, IKK 2, IKK B, IKK beta, IKK-B, IKK-beta, IKK2, IKKB, IKKB_HUMAN, Inhibitor of kappa Light Chain Gene Enhancer in B Cells, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells Kinase beta, Inhibitor of kappa Light Polypeptide Gene Enhancer in B Cells Kinase beta, Inhibitor of Nuclear Factor kappa B Kinase beta Subunit, Inhibitor of Nuclear Factor kappa B Kinase Subunit beta, Inhibitor of Nuclear Factor kappa-B Kinase Subunit beta, NFKBIKB, Nuclear Factor NF kappa B Inhibitor Kinase beta, Nuclear Factor NF-kappa-B Inhibitor Kinase beta, Nuclear Factor of kappa Light Chain Gene Enhancer in B Cells Inhibitor)

Sign In for Pricing
View Details
Alox12e (NM_145684) Mouse Tagged Lenti ORF Clone
MR209854L4 10 µg

Alox12e (NM_145684) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ifrd1 Rat shRNA Plasmid (Locus ID 29596)
TR710255 1 Kit

Ifrd1 Rat shRNA Plasmid (Locus ID 29596)

Sign In for Pricing
View Details
Trimethoprim (lactate)
C03391-01 100 mg

Trimethoprim (lactate)

Sign In for Pricing
View Details
Trimethoprim (lactate)
C03391-02 1 g

Trimethoprim (lactate)

Sign In for Pricing
View Details
Zanthobungeanine
PCA19094-01 5 mg

Zanthobungeanine

Sign In for Pricing
View Details