Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA17 Rabbit Polyclonal Antibody (FITC)

SPATA17 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IQCH, MOT17, FAP305, MSRG11, CFAP305, MSRG-11

UniProt

Q96L03

Immunogen

The immunogen for Anti-SPATA17 antibody is: synthetic peptide directed towards the N-terminal region of Human SPT17

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ARLQARSSTVGNQYYFRNSVVDPFRKKENDAAVKIQSWFRGCQVRAYIRH

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

XP_005273109.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibroblast Growth Factor 19 (FGF19) ELISA Kit
orb1807537-01 48 Tests

Human Fibroblast Growth Factor 19 (FGF19) ELISA Kit

Sign In for Pricing
View Details
Human Fibroblast Growth Factor 19 (FGF19) ELISA Kit
orb1807537-02 96 Tests

Human Fibroblast Growth Factor 19 (FGF19) ELISA Kit

Sign In for Pricing
View Details
ELISA Kit For Prolyl endopeptidase-like
E13245m 96 Tests

ELISA Kit For Prolyl endopeptidase-like

Sign In for Pricing
View Details
Histone H4 Antibody
orb621930-01 50 μL

Histone H4 Antibody

Sign In for Pricing
View Details
Histone H4 Antibody
orb621930-02 100 µL

Histone H4 Antibody

Sign In for Pricing
View Details
SELPLG Rabbit Polyclonal Antibody
E53P12630 100 µL

SELPLG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details