Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA17 Rabbit Polyclonal Antibody (HRP)

SPATA17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IQCH, MOT17, FAP305, MSRG11, CFAP305, MSRG-11

UniProt

Q96L03

Immunogen

The immunogen for Anti-SPATA17 antibody is: synthetic peptide directed towards the N-terminal region of Human SPT17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARLQARSSTVGNQYYFRNSVVDPFRKKENDAAVKIQSWFRGCQVRAYIRH

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

XP_005273109.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXF2B (NM_001099686) Human Over-expression Lysate
LC420497 20 µg

NXF2B (NM_001099686) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), 0.2mg/mL
BNUB2097-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), 0.2mg/mL

Sign In for Pricing
View Details
Apo-H Recombinant Rabbit Monoclonal Antibody [JE37-02]
HA721649 100 µL

Apo-H Recombinant Rabbit Monoclonal Antibody [JE37-02]

Sign In for Pricing
View Details
LYVE1 (NM_006691) Human Over-expression Lysate
LY402008 100 µg

LYVE1 (NM_006691) Human Over-expression Lysate

Sign In for Pricing
View Details
DHRS3 (Center) Rabbit Polyclonal Antibody
AP51254PU-N 400 µL

DHRS3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTEN Rabbit Monoclonal Antibody [Clone ID: R02-9D3]
TA385078 100 µL

PTEN Rabbit Monoclonal Antibody [Clone ID: R02-9D3]

Sign In for Pricing
View Details