Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA17 Rabbit Polyclonal Antibody (FITC)

SPATA17 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IQCH, MOT17, FAP305, MSRG11, CFAP305, MSRG-11

UniProt

Q96L03

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SPATA17

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_620151

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CORO1B (coronin, Actin Binding Protein, 1B, CORONIN-2, DKFZp762I166) (HRP)
244864-HRP 100 µL

CORO1B (coronin, Actin Binding Protein, 1B, CORONIN-2, DKFZp762I166) (HRP)

Sign In for Pricing
View Details
TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (HRP)
134274-HRP 100 µL

TCEA2 (Transcription Elongation Factor A Protein 2, Testis-specific S-II, Transcription Elongation Factor S-II Protein 2, Transcription Elongation Factor TFIIS.l) (HRP)

Sign In for Pricing
View Details
Upadacitinib Impurity 89
RM-U220089-01 10 mg

Upadacitinib Impurity 89

Sign In for Pricing
View Details
Upadacitinib Impurity 89
RM-U220089-02 25 mg

Upadacitinib Impurity 89

Sign In for Pricing
View Details
Upadacitinib Impurity 89
RM-U220089-03 50 mg

Upadacitinib Impurity 89

Sign In for Pricing
View Details
Upadacitinib Impurity 89
RM-U220089-04 100 mg

Upadacitinib Impurity 89

Sign In for Pricing
View Details