Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MITD1 Rabbit Polyclonal Antibody (FITC)

MITD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8WV92

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MITD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELK1 Protein, Human, Recombinant (His & GST Tag)
MBS8121201-01 0.1 mg

ELK1 Protein, Human, Recombinant (His & GST Tag)

Sign In for Pricing
View Details
ELK1 Protein, Human, Recombinant (His & GST Tag)
MBS8121201-02 5x 0.1 mg

ELK1 Protein, Human, Recombinant (His & GST Tag)

Sign In for Pricing
View Details
Recombinant Candida glabrata 21S rRNA pseudouridine (2819) synthase (PUS5)
MBS1433896-01 0.05 mg (E-Coli)

Recombinant Candida glabrata 21S rRNA pseudouridine (2819) synthase (PUS5)

Sign In for Pricing
View Details
Recombinant Candida glabrata 21S rRNA pseudouridine (2819) synthase (PUS5)
MBS1433896-02 0.05 mg (Yeast)

Recombinant Candida glabrata 21S rRNA pseudouridine (2819) synthase (PUS5)

Sign In for Pricing
View Details
Recombinant Candida glabrata 21S rRNA pseudouridine (2819) synthase (PUS5)
MBS1433896-03 0.2 mg (E-Coli)

Recombinant Candida glabrata 21S rRNA pseudouridine (2819) synthase (PUS5)

Sign In for Pricing
View Details
Recombinant Candida glabrata 21S rRNA pseudouridine (2819) synthase (PUS5)
MBS1433896-04 0.05 mg (Baculovirus)

Recombinant Candida glabrata 21S rRNA pseudouridine (2819) synthase (PUS5)

Sign In for Pricing
View Details